No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00008021-A01 |
Product name: | NUP214 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant NUP214. |
Gene id: | 8021 |
Gene name: | NUP214 |
Gene alias: | CAIN|CAN|D9S46E|MGC104525|N214 |
Gene description: | nucleoporin 214kDa |
Genbank accession: | NM_005085 |
Immunogen: | NUP214 (NP_005076, 1 a.a. ~ 97 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHH |
Protein accession: | NP_005076 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.78 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Oxidative Stress Inhibits Nuclear Protein Export by Multiple Mechanisms That Target FG Nucleoporins and Crm1.Crampton N, Kodiha M, Shrivastava S, Umar R, Stochaj U. Mol Biol Cell. 2009 Dec;20(24):5106-16. |