| Brand: | Abnova |
| Reference: | H00008019-M04 |
| Product name: | BRD3 monoclonal antibody (M04), clone 6F3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BRD3. |
| Clone: | 6F3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8019 |
| Gene name: | BRD3 |
| Gene alias: | FLJ23227|FLJ41328|KIAA0043|ORFX|RING3L |
| Gene description: | bromodomain containing 3 |
| Genbank accession: | BC032124 |
| Immunogen: | BRD3 (AAH32124, 418 a.a. ~ 556 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EPVEAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAGRDHFLTCGV |
| Protein accession: | AAH32124 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.92 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to BRD3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |