Brand: | Abnova |
Reference: | H00008013-M02 |
Product name: | NR4A3 monoclonal antibody (M02), clone 1E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NR4A3. |
Clone: | 1E9 |
Isotype: | IgG2a Kappa |
Gene id: | 8013 |
Gene name: | NR4A3 |
Gene alias: | CHN|CSMF|MINOR|NOR1|TEC |
Gene description: | nuclear receptor subfamily 4, group A, member 3 |
Genbank accession: | NM_006981 |
Immunogen: | NR4A3 (NP_008912, 414 a.a. ~ 521 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFS |
Protein accession: | NP_008912 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NR4A3 monoclonal antibody (M02), clone 1E9 Western Blot analysis of NR4A3 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |