| Brand: | Abnova |
| Reference: | H00007976-M02 |
| Product name: | FZD3 monoclonal antibody (M02), clone 1B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FZD3. |
| Clone: | 1B8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7976 |
| Gene name: | FZD3 |
| Gene alias: | Fz-3|hFz3 |
| Gene description: | frizzled homolog 3 (Drosophila) |
| Genbank accession: | NM_017412 |
| Immunogen: | FZD3 (NP_059108, 55 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV |
| Protein accession: | NP_059108 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged FZD3 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification of WNT/{beta}-CATENIN signaling pathway components in human cumulus cells.Wang HX, Tekpetey FR, Kidder GM. Mol Hum Reprod. 2009 Jan;15(1):11-7. Epub 2008 Nov 26. |