Brand: | Abnova |
Reference: | H00007957-M02 |
Product name: | EPM2A monoclonal antibody (M02), clone 6C6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EPM2A. |
Clone: | 6C6 |
Isotype: | IgG2a Kappa |
Gene id: | 7957 |
Gene name: | EPM2A |
Gene alias: | EPM2|MELF |
Gene description: | epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) |
Genbank accession: | NM_001018041 |
Immunogen: | EPM2A (NP_001018051, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIV |
Protein accession: | NP_001018051 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | EPM2A monoclonal antibody (M02), clone 6C6 Western Blot analysis of EPM2A expression in PC-12 ( Cat # L012V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Increased Laforin and Laforin Binding to Glycogen Underlie Lafora Body Formation in Malin-deficient Lafora Disease.Tiberia E, Turnbull J, Wang T, Ruggieri A, Zhao XC, Pencea N, Israelian J, Wang Y, Ackerley CA, Wang P, Liu Y, Minassian BA. J Biol Chem. 2012 Jul 20;287(30):25650-9. Epub 2012 Jun 5. |