Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EPM2A monoclonal antibody (M01), clone 4A12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about EPM2A monoclonal antibody (M01), clone 4A12
| Brand: | Abnova |
| Reference: | H00007957-M01 |
| Product name: | EPM2A monoclonal antibody (M01), clone 4A12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EPM2A. |
| Clone: | 4A12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7957 |
| Gene name: | EPM2A |
| Gene alias: | EPM2|MELF |
| Gene description: | epilepsy, progressive myoclonus type 2A, Lafora disease (laforin) |
| Genbank accession: | NM_001018041 |
| Immunogen: | EPM2A (NP_001018051, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIV |
| Protein accession: | NP_001018051 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | EPM2A monoclonal antibody (M01), clone 4A12. Western Blot analysis of EPM2A expression in PC-12 ( Cat # L012V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A Bioassay for Lafora Disease and Laforin Glucan Phosphatase Activity.Sherwood AR, Johnson MB, Delgado-Escueta AV, Gentry MS Clin Biochem. 2013 Sep 6. pii: S0009-9120(13)00395-0. doi: 10.1016/j.clinbiochem.2013.08.016. |