Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HSD17B8 monoclonal antibody (M01), clone 4F1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
More info about HSD17B8 monoclonal antibody (M01), clone 4F1
| Brand: | Abnova |
| Reference: | H00007923-M01 |
| Product name: | HSD17B8 monoclonal antibody (M01), clone 4F1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HSD17B8. |
| Clone: | 4F1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7923 |
| Gene name: | HSD17B8 |
| Gene alias: | D6S2245E|FABG|FABGL|H2-KE6|HKE6|KE6|RING2|SDR30C1|dJ1033B10.9 |
| Gene description: | hydroxysteroid (17-beta) dehydrogenase 8 |
| Genbank accession: | NM_014234 |
| Immunogen: | HSD17B8 (NP_055049, 28 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVN |
| Protein accession: | NP_055049 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HSD17B8 monoclonal antibody (M01), clone 4F1. Western Blot analysis of HSD17B8 expression in human pancreas. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |