HSD17B8 purified MaxPab rabbit polyclonal antibody (D01P) View larger

HSD17B8 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSD17B8 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about HSD17B8 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00007923-D01P
Product name: HSD17B8 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human HSD17B8 protein.
Gene id: 7923
Gene name: HSD17B8
Gene alias: D6S2245E|FABG|FABGL|H2-KE6|HKE6|KE6|RING2|SDR30C1|dJ1033B10.9
Gene description: hydroxysteroid (17-beta) dehydrogenase 8
Genbank accession: NM_014234.3
Immunogen: HSD17B8 (NP_055049.1, 1 a.a. ~ 261 a.a) full-length human protein.
Immunogen sequence/protein sequence: MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM
Protein accession: NP_055049.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00007923-D01P-13-15-1.jpg
Application image note: Western Blot analysis of HSD17B8 expression in transfected 293T cell line (H00007923-T03) by HSD17B8 MaxPab polyclonal antibody.

Lane 1: HSD17B8 transfected lysate(27.00 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HSD17B8 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart