HSD17B8 MaxPab mouse polyclonal antibody (B01) View larger

HSD17B8 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSD17B8 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about HSD17B8 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00007923-B01
Product name: HSD17B8 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human HSD17B8 protein.
Gene id: 7923
Gene name: HSD17B8
Gene alias: D6S2245E|FABG|FABGL|H2-KE6|HKE6|KE6|RING2|SDR30C1|dJ1033B10.9
Gene description: hydroxysteroid (17-beta) dehydrogenase 8
Genbank accession: BC008185
Immunogen: HSD17B8 (AAH08185, 1 a.a. ~ 261 a.a) full-length human protein.
Immunogen sequence/protein sequence: MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQINYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM
Protein accession: AAH08185
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007923-B01-13-15-1.jpg
Application image note: Western Blot analysis of HSD17B8 expression in transfected 293T cell line (H00007923-T01) by HSD17B8 MaxPab polyclonal antibody.

Lane 1: HSD17B8 transfected lysate(28.82 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HSD17B8 MaxPab mouse polyclonal antibody (B01) now

Add to cart