Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00007923-B01 |
Product name: | HSD17B8 MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human HSD17B8 protein. |
Gene id: | 7923 |
Gene name: | HSD17B8 |
Gene alias: | D6S2245E|FABG|FABGL|H2-KE6|HKE6|KE6|RING2|SDR30C1|dJ1033B10.9 |
Gene description: | hydroxysteroid (17-beta) dehydrogenase 8 |
Genbank accession: | BC008185 |
Immunogen: | HSD17B8 (AAH08185, 1 a.a. ~ 261 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQINYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM |
Protein accession: | AAH08185 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HSD17B8 expression in transfected 293T cell line (H00007923-T01) by HSD17B8 MaxPab polyclonal antibody. Lane 1: HSD17B8 transfected lysate(28.82 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |