No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00007919-A01 |
Product name: | BAT1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant BAT1. |
Gene id: | 7919 |
Gene name: | BAT1 |
Gene alias: | D6S81E|DDX39B|UAP56 |
Gene description: | HLA-B associated transcript 1 |
Genbank accession: | NM_004640 |
Immunogen: | BAT1 (NP_004631, 329 a.a. ~ 428 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | RYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR |
Protein accession: | NP_004631 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | BAT1 polyclonal antibody (A01), Lot # GTH0060529QCS1 Western Blot analysis of BAT1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | A dual reporter approach to quantify defects in mRNA processing.Banerjee A, Sammarco MC, Ditch S, Grabczyk E. Anal Biochem. 2009 Dec 15;395(2):237-43. Epub 2009 Sep 3. |