Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ST8SIA4 monoclonal antibody (M03), clone 1H5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA |
More info about ST8SIA4 monoclonal antibody (M03), clone 1H5
| Brand: | Abnova |
| Reference: | H00007903-M03 |
| Product name: | ST8SIA4 monoclonal antibody (M03), clone 1H5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ST8SIA4. |
| Clone: | 1H5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7903 |
| Gene name: | ST8SIA4 |
| Gene alias: | MGC34450|MGC61459|PST|PST1|SIAT8D|ST8SIA-IV |
| Gene description: | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 |
| Genbank accession: | BC027866 |
| Immunogen: | ST8SIA4 (AAH27866, 1 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRSIRKKWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR |
| Protein accession: | AAH27866 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ST8SIA4 monoclonal antibody (M03), clone 1H5. Western Blot analysis of ST8SIA4 expression in human kidney. |
| Applications: | WB-Ti,ELISA |
| Shipping condition: | Dry Ice |