View larger

MAPKAPK3 polyclonal antibody (A02)

Reference:

Condition: New product

Data sheet of MAPKAPK3 polyclonal antibody (A02)

Brand:	Abnova
Reference:	H00007867-A02
Product name:	MAPKAPK3 polyclonal antibody (A02)
Product description:	Mouse polyclonal antibody raised against a partial recombinant MAPKAPK3.
Gene id:	7867
Gene name:	MAPKAPK3
Gene alias:	3PK\|MAPKAP3
Gene description:	mitogen-activated protein kinase-activated protein kinase 3
Genbank accession:	BC001662
Immunogen:	MAPKAPK3 (AAH01662, 272 a.a. ~ 382 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	EVSEDAKQLIRLLLKTDPTERLTITQFMNHPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSASQGCNNQ
Protein accession:	AAH01662
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (38.21 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice