| Brand: | Abnova |
| Reference: | H00007857-M01 |
| Product name: | SCG2 monoclonal antibody (M01), clone 6B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SCG2. |
| Clone: | 6B7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7857 |
| Gene name: | SCG2 |
| Gene alias: | CHGC|SN|SgII |
| Gene description: | secretogranin II (chromogranin C) |
| Genbank accession: | NM_003469 |
| Immunogen: | SCG2 (NP_003460, 508 a.a. ~ 617 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM |
| Protein accession: | NP_003460 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |