No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr,IP,PLA-Ce |
Brand: | Abnova |
Reference: | H00007855-M01 |
Product name: | FZD5 monoclonal antibody (M01), clone 6A3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FZD5. |
Clone: | 6A3 |
Isotype: | IgG2a Kappa |
Gene id: | 7855 |
Gene name: | FZD5 |
Gene alias: | C2orf31|DKFZp434E2135|HFZ5|MGC129692 |
Gene description: | frizzled homolog 5 (Drosophila) |
Genbank accession: | NM_003468 |
Immunogen: | FZD5 (ENSP00000354607, 72 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPR |
Protein accession: | ENSP00000354607 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged FZD5 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP,PLA-Ce |
Shipping condition: | Dry Ice |
Publications: | Frizzled-5: a high affinity receptor for secreted frizzled-related protein-2 activation of nuclear factor of activated T-cells c3 signaling to promote angiogenesis.Peterson YK, Nasarre P, Bonilla IV, Hilliard E, Samples J, Morinelli TA, Hill EG, Klauber-DeMore N. Angiogenesis. 2017 Aug 24. [Epub ahead of print] |