Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FZD5 monoclonal antibody (M01), clone 6A3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,IP,PLA-Ce |
More info about FZD5 monoclonal antibody (M01), clone 6A3
| Brand: | Abnova |
| Reference: | H00007855-M01 |
| Product name: | FZD5 monoclonal antibody (M01), clone 6A3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FZD5. |
| Clone: | 6A3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7855 |
| Gene name: | FZD5 |
| Gene alias: | C2orf31|DKFZp434E2135|HFZ5|MGC129692 |
| Gene description: | frizzled homolog 5 (Drosophila) |
| Genbank accession: | NM_003468 |
| Immunogen: | FZD5 (ENSP00000354607, 72 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPR |
| Protein accession: | ENSP00000354607 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged FZD5 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | Frizzled-5: a high affinity receptor for secreted frizzled-related protein-2 activation of nuclear factor of activated T-cells c3 signaling to promote angiogenesis.Peterson YK, Nasarre P, Bonilla IV, Hilliard E, Samples J, Morinelli TA, Hill EG, Klauber-DeMore N. Angiogenesis. 2017 Aug 24. [Epub ahead of print] |