FZD5 polyclonal antibody (A01) View larger

FZD5 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FZD5 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about FZD5 polyclonal antibody (A01)

Brand: Abnova
Reference: H00007855-A01
Product name: FZD5 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant FZD5.
Gene id: 7855
Gene name: FZD5
Gene alias: C2orf31|DKFZp434E2135|HFZ5|MGC129692
Gene description: frizzled homolog 5 (Drosophila)
Genbank accession: NM_003468
Immunogen: FZD5 (ENSP00000354607, 72 a.a. ~ 161 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPR
Protein accession: ENSP00000354607
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007855-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.01 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FZD5 polyclonal antibody (A01) now

Add to cart