Brand: | Abnova |
Reference: | H00007852-M03 |
Product name: | CXCR4 monoclonal antibody (M03), clone 2A9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CXCR4. |
Clone: | 2A9 |
Isotype: | IgG1 Kappa |
Gene id: | 7852 |
Gene name: | CXCR4 |
Gene alias: | CD184|D2S201E|FB22|HM89|HSY3RR|LAP3|LCR1|LESTR|NPY3R|NPYR|NPYRL|NPYY3R|WHIM |
Gene description: | chemokine (C-X-C motif) receptor 4 |
Genbank accession: | BC020968 |
Immunogen: | CXCR4 (AAH20968, 1 a.a. ~ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS |
Protein accession: | AAH20968 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (30.8 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CXCR4 monoclonal antibody (M03), clone 2A9. Western Blot analysis of CXCR4 expression in human uterus myoma. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |