| Brand: | Abnova |
| Reference: | H00007852-M02A |
| Product name: | CXCR4 monoclonal antibody (M02A), clone 1F8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CXCR4. |
| Clone: | 1F8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7852 |
| Gene name: | CXCR4 |
| Gene alias: | CD184|D2S201E|FB22|HM89|HSY3RR|LAP3|LCR1|LESTR|NPY3R|NPYR|NPYRL|NPYY3R|WHIM |
| Gene description: | chemokine (C-X-C motif) receptor 4 |
| Genbank accession: | BC020968 |
| Immunogen: | CXCR4 (AAH20968, 1 a.a. ~ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS |
| Protein accession: | AAH20968 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (30.8 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CXCR4 monoclonal antibody (M02A), clone 1F8. Western Blot analysis of CXCR4 expression in human Intestinal wall. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |