Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CXCR4 monoclonal antibody (M01), clone 2H5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about CXCR4 monoclonal antibody (M01), clone 2H5
| Brand: | Abnova |
| Reference: | H00007852-M01 |
| Product name: | CXCR4 monoclonal antibody (M01), clone 2H5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CXCR4. |
| Clone: | 2H5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7852 |
| Gene name: | CXCR4 |
| Gene alias: | CD184|D2S201E|FB22|HM89|HSY3RR|LAP3|LCR1|LESTR|NPY3R|NPYR|NPYRL|NPYY3R|WHIM |
| Gene description: | chemokine (C-X-C motif) receptor 4 |
| Genbank accession: | BC020968 |
| Immunogen: | CXCR4 (AAH20968, 1 a.a. ~ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS |
| Protein accession: | AAH20968 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (30.8 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CXCR4 expression in transfected 293T cell line by CXCR4 monoclonal antibody (M01), clone 2H5. Lane 1: CXCR4 transfected lysate(40.48 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Nuclear expression of CXCR4 is associated with advanced colorectal cancer.Wang SC, Lin JK, Wang HS, Yang SH, Li AF, Chang SC. Int J Colorectal Dis. 2010 Oct;25(10):1185-91. Epub 2010 Jul 7. |