Cart 9 Product Products 2 776,34 € (empty)
No products
To be determined Shipping
2 776,34 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 9 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 776,34 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 776,34 €
Data sheet of PAX8 monoclonal antibody (M10), clone 3G11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
More info about PAX8 monoclonal antibody (M10), clone 3G11
| Brand: | Abnova |
| Reference: | H00007849-M10 |
| Product name: | PAX8 monoclonal antibody (M10), clone 3G11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PAX8. |
| Clone: | 3G11 |
| Isotype: | IgG2b Kappa |
| Gene id: | 7849 |
| Gene name: | PAX8 |
| Gene alias: | - |
| Gene description: | paired box 8 |
| Genbank accession: | NM_003466 |
| Immunogen: | PAX8 (NP_003457, 300 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPH |
| Protein accession: | NP_003457 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.32 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PAX8 monoclonal antibody (M10), clone 3G11. Western Blot analysis of PAX8 expression in human parotid gland. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |