PAX8 monoclonal antibody (M09C), clone 3H7 View larger

PAX8 monoclonal antibody (M09C), clone 3H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PAX8 monoclonal antibody (M09C), clone 3H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PAX8 monoclonal antibody (M09C), clone 3H7

Brand: Abnova
Reference: H00007849-M09C
Product name: PAX8 monoclonal antibody (M09C), clone 3H7
Product description: Mouse monoclonal antibody raised against a full-length recombinant PAX8.
Clone: 3H7
Isotype: IgG2a Kappa
Gene id: 7849
Gene name: PAX8
Gene alias: -
Gene description: paired box 8
Genbank accession: BC001060.2
Immunogen: PAX8 (AAH01060.1, 1 a.a. ~ 450 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL
Protein accession: AAH01060.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007849-M09C-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (75.13 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PAX8 monoclonal antibody (M09C), clone 3H7 now

Add to cart