No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Tr |
Brand: | Abnova |
Reference: | H00007849-M05 |
Product name: | PAX8 monoclonal antibody (M05), clone 3E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PAX8. |
Clone: | 3E9 |
Isotype: | IgG2a Kappa |
Gene id: | 7849 |
Gene name: | PAX8 |
Gene alias: | - |
Gene description: | paired box 8 |
Genbank accession: | NM_003466 |
Immunogen: | PAX8 (NP_003457, 300 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPH |
Protein accession: | NP_003457 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged PAX8 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Tr |
Shipping condition: | Dry Ice |