Cart 3 Product Products 1 357,07 € (empty)
-
1 x Caspase-8...259,07 € -
-
No products
To be determined Shipping
1 357,07 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 357,07 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 357,07 €
Data sheet of PAX8 monoclonal antibody (M05), clone 3E9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Tr |
More info about PAX8 monoclonal antibody (M05), clone 3E9
| Brand: | Abnova |
| Reference: | H00007849-M05 |
| Product name: | PAX8 monoclonal antibody (M05), clone 3E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PAX8. |
| Clone: | 3E9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7849 |
| Gene name: | PAX8 |
| Gene alias: | - |
| Gene description: | paired box 8 |
| Genbank accession: | NM_003466 |
| Immunogen: | PAX8 (NP_003457, 300 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPH |
| Protein accession: | NP_003457 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PAX8 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |