| Brand: | Abnova |
| Reference: | H00007849-M03 |
| Product name: | PAX8 monoclonal antibody (M03), clone 3B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PAX8. |
| Clone: | 3B11 |
| Isotype: | IgG2b Kappa |
| Gene id: | 7849 |
| Gene name: | PAX8 |
| Gene alias: | - |
| Gene description: | paired box 8 |
| Genbank accession: | NM_003466 |
| Immunogen: | PAX8 (NP_003457, 300 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPH |
| Protein accession: | NP_003457 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.32 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | PAX8 monoclonal antibody (M03), clone 3B11. Western Blot analysis of PAX8 expression in RIN-m5F. (60kD,Endocrinology Vol. 140, No. 10 4651-4658,http://endo.endojournals.org/cgi/content/full/140/10/4651) |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |