Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CSDE1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about CSDE1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00007812-A01 |
| Product name: | CSDE1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CSDE1. |
| Gene id: | 7812 |
| Gene name: | CSDE1 |
| Gene alias: | D1S155E|DKFZp779B0247|DKFZp779J1455|FLJ26882|RP5-1000E10.3|UNR |
| Gene description: | cold shock domain containing E1, RNA-binding |
| Genbank accession: | NM_007158 |
| Immunogen: | CSDE1 (NP_009089, 670 a.a. ~ 765 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | HVKEVQDGIELQAGDEVEFSVILNQRTGKCSACNVWRVCEGPKAVAAPRPDRLVNRLKNITLDDASAPRLMVLRQPRGPDNSMGFGAERKIRQAGV |
| Protein accession: | NP_009089 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CSDE1 expression in transfected 293T cell line by CSDE1 polyclonal antibody (A01). Lane1:CSDE1 transfected lysate(88.885 KDa). Lane2:Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |