View larger

ZNF148 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of ZNF148 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00007707-A01
Product name:	ZNF148 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant ZNF148.
Gene id:	7707
Gene name:	ZNF148
Gene alias:	BERF-1\|BFCOL1\|HT-BETA\|ZBP-89\|ZFP148\|pHZ-52
Gene description:	zinc finger protein 148
Genbank accession:	NM_021964
Immunogen:	ZNF148 (NP_068799, 695 a.a. ~ 794 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	NHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAGMTSSPDATTGQTFG
Protein accession:	NP_068799
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.11 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice