| Brand: | Abnova |
| Reference: | H00007704-M01 |
| Product name: | ZBTB16 monoclonal antibody (M01), clone 3A7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZBTB16. |
| Clone: | 3A7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7704 |
| Gene name: | ZBTB16 |
| Gene alias: | PLZF|ZNF145 |
| Gene description: | zinc finger and BTB domain containing 16 |
| Genbank accession: | BC029812 |
| Immunogen: | ZBTB16 (AAH29812, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVEQHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR |
| Protein accession: | AAH29812 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ZBTB16 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |