| Brand: | Abnova |
| Reference: | H00007697-M01 |
| Product name: | ZNF138 monoclonal antibody (M01), clone 4D11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF138. |
| Clone: | 4D11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7697 |
| Gene name: | ZNF138 |
| Gene alias: | pHZ-32 |
| Gene description: | zinc finger protein 138 |
| Genbank accession: | NM_006524 |
| Immunogen: | ZNF138 (NP_006515.1, 151 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TNLSKPKKIHTGEKPYKCEVCGKAFHQSSILTKHKIIRTGEKPYKCAHCGKAFKQSSHLTRHKIIHTEEKPYKCEQCGKVFKQSPTLTKHQIIYTGEEPYK |
| Protein accession: | NP_006515.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ZNF138 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |