ZNF137 MaxPab mouse polyclonal antibody (B01) View larger

ZNF137 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF137 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ZNF137 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00007696-B01
Product name: ZNF137 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human ZNF137 protein.
Gene id: 7696
Gene name: ZNF137
Gene alias: MGC119990|MGC119991|pHZ-30
Gene description: zinc finger protein 137
Genbank accession: NM_003438.2
Immunogen: ZNF137 (NP_003429.1, 1 a.a. ~ 207 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNVARFLVEKHTLHVIIDFILSKVSNQQSNLAQHQRVYTGEKPYKCNEWGKALSGKSSLFYHQAIHGVGKLCKCNDCHKVFSNATTIANHWRIHNEDRSYKCNKCGKIFRHRSYLAVYQRTHTGEKPYKYHDCGKVFSQASSYAKHRRIHTGEKPHKCDDCGKVLTSRSHLIRHQRIHTGQKSYKCLKCGKVFSLWALHAEHQKIHF
Protein accession: NP_003429.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007696-B01-13-15-1.jpg
Application image note: Western Blot analysis of ZNF137 expression in transfected 293T cell line (H00007696-T01) by ZNF137 MaxPab polyclonal antibody.

Lane 1: ZNF137 transfected lysate(22.77 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF137 MaxPab mouse polyclonal antibody (B01) now

Add to cart