| Brand: | Abnova |
| Reference: | H00007690-M07 |
| Product name: | ZNF131 monoclonal antibody (M07), clone 5F1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF131. |
| Clone: | 5F1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7690 |
| Gene name: | ZNF131 |
| Gene alias: | pHZ-10 |
| Gene description: | zinc finger protein 131 |
| Genbank accession: | BC035875 |
| Immunogen: | ZNF131 (AAH35875, 139 a.a. ~ 238 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TSKYRQGDRKGQIKEDGCPSDPTSKQEHMKSHSTESFKCEICNKRYLRESAWKQHLNCYHLEEGGVSKKQRTGKKIHVCQYCEKQFDHFGHFKEHLRKHT |
| Protein accession: | AAH35875 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ZNF131 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Kaiso Regulates Znf131-Mediated Transcriptional Activation.Donaldson NS, Nordgaard CL, Pierre CC, Kelly KF, Robinson S, Swystun L, Henriquez R, Graham M, Daniel JM. Exp Cell Res. 2010 Mar 18. [Epub ahead of print] |