| Brand: | Abnova |
| Reference: | H00007639-M05 |
| Product name: | ZNF85 monoclonal antibody (M05), clone 2F5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF85. |
| Clone: | 2F5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7639 |
| Gene name: | ZNF85 |
| Gene alias: | HPF4|HTF1|MGC78566 |
| Gene description: | zinc finger protein 85 |
| Genbank accession: | NM_003429 |
| Immunogen: | ZNF85 (NP_003420, 2 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKEAWSMKRHEIMVAKPT |
| Protein accession: | NP_003420 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |