| Brand: | Abnova |
| Reference: | H00007621-M02 |
| Product name: | ZNF70 monoclonal antibody (M02), clone 3F8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ZNF70. |
| Clone: | 3F8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7621 |
| Gene name: | ZNF70 |
| Gene alias: | Cos17|MGC48959 |
| Gene description: | zinc finger protein 70 |
| Genbank accession: | BC040161 |
| Immunogen: | ZNF70 (AAH40161, 1 a.a. ~ 446 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSALTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSSLIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL |
| Protein accession: | AAH40161 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (74.8 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ZNF70 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |