No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00007592-M04 |
| Product name: | ZNF41 monoclonal antibody (M04), clone 2C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF41. |
| Clone: | 2C5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7592 |
| Gene name: | ZNF41 |
| Gene alias: | MGC8941|MRX89 |
| Gene description: | zinc finger protein 41 |
| Genbank accession: | NM_007130 |
| Immunogen: | ZNF41 (NP_009061, 221 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GNNFPHSPSSTKNENAKTGANSCEHDHYEKHLSHKQAPTHHQKIHPEEKLYVCTECVMGFTQKSHLFEHQRIHAGEKSRECDKSNKVFPQKPQVDVHPSV* |
| Protein accession: | NP_009061 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of ZNF41 expression in transfected 293T cell line by ZNF41 monoclonal antibody (M04), clone 2C5. Lane 1: ZNF41 transfected lysate (Predicted MW: 89.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |