No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00007589-M18 |
Product name: | ZSCAN21 monoclonal antibody (M18), clone 2A8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ZSCAN21. |
Clone: | 2A8 |
Isotype: | IgG2a Kappa |
Gene id: | 7589 |
Gene name: | ZSCAN21 |
Gene alias: | DKFZp434L134|DKFZp686H10254|NY-REN-21|ZNF38|Zipro1 |
Gene description: | zinc finger and SCAN domain containing 21 |
Genbank accession: | NM_145914 |
Immunogen: | ZSCAN21 (NP_666019, 136 a.a. ~ 224 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDI |
Protein accession: | NP_666019 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ZSCAN21 expression in transfected 293T cell line by ZSCAN21 monoclonal antibody (M18), clone 2A8. Lane 1: ZSCAN21 transfected lysate(50.9 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |