| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00007589-M16 |
| Product name: | ZSCAN21 monoclonal antibody (M16), clone 4F10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ZSCAN21. |
| Clone: | 4F10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7589 |
| Gene name: | ZSCAN21 |
| Gene alias: | DKFZp434L134|DKFZp686H10254|NY-REN-21|ZNF38|Zipro1 |
| Gene description: | zinc finger and SCAN domain containing 21 |
| Genbank accession: | NM_145914 |
| Immunogen: | ZSCAN21 (NP_666019, 136 a.a. ~ 224 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDI |
| Protein accession: | NP_666019 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of ZSCAN21 expression in transfected 293T cell line by ZNF38 monoclonal antibody (M16), clone 4F10. Lane 1: ZSCAN21 transfected lysate(50.9 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |