| Brand: | Abnova |
| Reference: | H00007576-M01 |
| Product name: | ZNF28 monoclonal antibody (M01), clone 8H6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ZNF28. |
| Clone: | 8H6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7576 |
| Gene name: | ZNF28 |
| Gene alias: | DKFZp781D0275|KOX24 |
| Gene description: | zinc finger protein 28 |
| Genbank accession: | BC070146.1 |
| Immunogen: | ZNF28 (AAH70146.1, 1 a.a. ~ 74 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLGEDNLLGMCPCVSLYFLLLPLGSHILT |
| Protein accession: | AAH70146.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | ZNF28 monoclonal antibody (M01), clone 8H6. Western Blot analysis of ZNF28 expression in Hela S3 NE. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |