| Brand: | Abnova |
| Reference: | H00007569-M03 |
| Product name: | ZNF21 monoclonal antibody (M03), clone 6D11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF21. |
| Clone: | 6D11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7569 |
| Gene name: | ZNF182 |
| Gene alias: | HHZ150|KOX14|MGC125383|MGC131713|ZNF21|Zfp182 |
| Gene description: | zinc finger protein 182 |
| Genbank accession: | NM_006962 |
| Immunogen: | ZNF21 (NP_008893, 81 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VEECPAEGKIPFWNFPEVCQVDEQIERQHQDDQDKCLLMQVGFSDKKTIITKSARDCHEFGNILHLSTNLVASIQRPDKHESFGNNMVDNLDLFSRSSAENKYDNGCAKL |
| Protein accession: | NP_008893 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ZNF21 monoclonal antibody (M03), clone 6D11 Western Blot analysis of ZNF21 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |