View larger

ZNF7 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of ZNF7 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00007553-A01
Product name:	ZNF7 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant ZNF7.
Gene id:	7553
Gene name:	ZNF7
Gene alias:	FLJ38706\|HF.16\|KOX4\|zf30
Gene description:	zinc finger protein 7
Genbank accession:	NM_003416
Immunogen:	ZNF7 (NP_003407, 67 a.a. ~ 165 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	DLQGAEGTEAPRTSKTDSTIRTENEQACEDMDILKSESYGTVVRISPQDFPQNPGFGDVSDSEVWLDSHLGSPGLKVTGFTFQNNCLNEETVVPKTFTK
Protein accession:	NP_003407
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	ZNF7 polyclonal antibody (A01), Lot # 061103JCS1 Western Blot analysis of ZNF7 expression in 293 ( Cat # L026V1 ).
Applications:	WB-Ce,ELISA,WB-Re
Shipping condition:	Dry Ice