No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00007547-M04 |
Product name: | ZIC3 monoclonal antibody (M04), clone 4G6 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ZIC3. |
Clone: | 4G6 |
Isotype: | IgG2b Kappa |
Gene id: | 7547 |
Gene name: | ZIC3 |
Gene alias: | HTX|HTX1|ZNF203 |
Gene description: | Zic family member 3 (odd-paired homolog, Drosophila) |
Genbank accession: | NM_003413 |
Immunogen: | ZIC3 (NP_003404.1, 182 a.a. ~ 274 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFST |
Protein accession: | NP_003404.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged ZIC3 is approximately 30ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |