ZIC3 monoclonal antibody (M02), clone 2D3 View larger

ZIC3 monoclonal antibody (M02), clone 2D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZIC3 monoclonal antibody (M02), clone 2D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ZIC3 monoclonal antibody (M02), clone 2D3

Brand: Abnova
Reference: H00007547-M02
Product name: ZIC3 monoclonal antibody (M02), clone 2D3
Product description: Mouse monoclonal antibody raised against a full length recombinant ZIC3.
Clone: 2D3
Isotype: IgG2b Kappa
Gene id: 7547
Gene name: ZIC3
Gene alias: HTX|HTX1|ZNF203
Gene description: Zic family member 3 (odd-paired homolog, Drosophila)
Genbank accession: NM_003413
Immunogen: ZIC3 (NP_003404.1, 182 a.a. ~ 274 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFST
Protein accession: NP_003404.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007547-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.86 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged ZIC3 is approximately 30ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZIC3 monoclonal antibody (M02), clone 2D3 now

Add to cart