No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00007545-M14 |
Product name: | ZIC1 monoclonal antibody (M14), clone 1E6 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ZIC1. |
Clone: | 1E6 |
Isotype: | IgG2a Kappa |
Gene id: | 7545 |
Gene name: | ZIC1 |
Gene alias: | ZIC|ZNF201 |
Gene description: | Zic family member 1 (odd-paired homolog, Drosophila) |
Genbank accession: | NM_003412 |
Immunogen: | ZIC1 (NP_003403, 139 a.a. ~ 212 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GHLLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYPRPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHHGAGA |
Protein accession: | NP_003403 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (34.14 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | ZIC1 monoclonal antibody (M14), clone 1E6. Western Blot analysis of ZIC1 expression in MCF-7. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |