| Brand: | Abnova |
| Reference: | H00007545-M06 |
| Product name: | ZIC1 monoclonal antibody (M06), clone 4D2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ZIC1. |
| Clone: | 4D2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7545 |
| Gene name: | ZIC1 |
| Gene alias: | ZIC|ZNF201 |
| Gene description: | Zic family member 1 (odd-paired homolog, Drosophila) |
| Genbank accession: | NM_003412 |
| Immunogen: | ZIC1 (NP_003403, 139 a.a. ~ 212 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GHLLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYPRPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHHGAGA |
| Protein accession: | NP_003403 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.14 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ZIC1 monoclonal antibody (M06), clone 4D2. Western Blot analysis of ZIC1 expression in HeLa. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |