Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00007536-M01A |
Product name: | SF1 monoclonal antibody (M01A), clone 2E12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SF1. |
Clone: | 2E12 |
Isotype: | IgG2a Kappa |
Gene id: | 7536 |
Gene name: | SF1 |
Gene alias: | D11S636|ZFM1|ZNF162 |
Gene description: | splicing factor 1 |
Genbank accession: | NM_004630 |
Immunogen: | SF1 (NP_004621, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERH |
Protein accession: | NP_004621 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Western Blot analysis of SF1 expression in transfected 293T cell line by SF1 monoclonal antibody (M01A), clone 2E12. Lane 1: SF1 transfected lysate (Predicted MW: 59.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.Crisci A, Raleff F, Bagdiul I, Raabe M, Urlaub H, Rain JC, Kramer A. Nucleic Acids Res. 2015 Sep 29. |