Cart 2 Product Products 664,00 € (empty)
No products
To be determined Shipping
664,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 664,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 664,00 €
Data sheet of SF1 monoclonal antibody (M01A), clone 2E12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about SF1 monoclonal antibody (M01A), clone 2E12
| Brand: | Abnova |
| Reference: | H00007536-M01A |
| Product name: | SF1 monoclonal antibody (M01A), clone 2E12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SF1. |
| Clone: | 2E12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7536 |
| Gene name: | SF1 |
| Gene alias: | D11S636|ZFM1|ZNF162 |
| Gene description: | splicing factor 1 |
| Genbank accession: | NM_004630 |
| Immunogen: | SF1 (NP_004621, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERH |
| Protein accession: | NP_004621 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Western Blot analysis of SF1 expression in transfected 293T cell line by SF1 monoclonal antibody (M01A), clone 2E12. Lane 1: SF1 transfected lysate (Predicted MW: 59.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.Crisci A, Raleff F, Bagdiul I, Raabe M, Urlaub H, Rain JC, Kramer A. Nucleic Acids Res. 2015 Sep 29. |