No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00007533-M07 |
Product name: | YWHAH monoclonal antibody (M07), clone 1C2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant YWHAH. |
Clone: | 1C2 |
Isotype: | IgG1 Kappa |
Gene id: | 7533 |
Gene name: | YWHAH |
Gene alias: | YWHA1 |
Gene description: | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide |
Genbank accession: | BC003047 |
Immunogen: | YWHAH (AAH03047, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHP |
Protein accession: | AAH03047 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |