| Brand: | Abnova |
| Reference: | H00007532-M02 |
| Product name: | YWHAG monoclonal antibody (M02), clone 6A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant YWHAG. |
| Clone: | 6A10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 7532 |
| Gene name: | YWHAG |
| Gene alias: | 14-3-3GAMMA |
| Gene description: | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide |
| Genbank accession: | NM_012479 |
| Immunogen: | YWHAG (NP_036611, 70 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTH |
| Protein accession: | NP_036611 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | YWHAG monoclonal antibody (M02), clone 6A10 Western Blot analysis of YWHAG expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |