| Brand: | Abnova |
| Reference: | H00007531-A01 |
| Product name: | YWHAE polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant YWHAE. |
| Gene id: | 7531 |
| Gene name: | YWHAE |
| Gene alias: | 14-3-3E|FLJ45465|KCIP-1|MDCR|MDS |
| Gene description: | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide |
| Genbank accession: | BC000179 |
| Immunogen: | YWHAE (AAH00179, 1 a.a. ~ 255 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ |
| Protein accession: | AAH00179 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (54.16 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | AUS DEM LEHRSTUHL FUR INNERE MEDIZIN II.LARS MAIER. Inaugural-Dissertation zur Erlangung des Doktorgrades der Medizin |