Brand: | Abnova |
Reference: | H00007528-M01A |
Product name: | YY1 monoclonal antibody (M01A), clone 2C4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant YY1. |
Clone: | 2C4 |
Isotype: | IgG1 Kappa |
Gene id: | 7528 |
Gene name: | YY1 |
Gene alias: | DELTA|INO80S|NF-E1|UCRBP|YIN-YANG-1 |
Gene description: | YY1 transcription factor |
Genbank accession: | NM_003403 |
Immunogen: | YY1 (NP_003394, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH |
Protein accession: | NP_003394 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | YY1 monoclonal antibody (M01A), clone 2C4 Western Blot analysis of YY1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |