| Brand: | Abnova |
| Reference: | H00007525-M02A |
| Product name: | YES1 monoclonal antibody (M02A), clone 3C6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant YES1. |
| Clone: | 3C6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 7525 |
| Gene name: | YES1 |
| Gene alias: | HsT441|P61-YES|Yes|c-yes |
| Gene description: | v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 |
| Genbank accession: | BC048960 |
| Immunogen: | YES1 (AAH48960, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSV |
| Protein accession: | AAH48960 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.54 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | YES1 monoclonal antibody (M02A), clone 3C6 Western Blot analysis of YES1 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |