Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00007507-M01 |
Product name: | XPA monoclonal antibody (M01), clone 2E4 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant XPA. |
Clone: | 2E4 |
Isotype: | IgG2a Kappa |
Gene id: | 7507 |
Gene name: | XPA |
Gene alias: | XP1|XPAC |
Gene description: | xeroderma pigmentosum, complementation group A |
Genbank accession: | NM_000380.2 |
Immunogen: | XPA (NP_000371.1, 1 a.a. ~ 273 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM |
Protein accession: | NP_000371.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (57.8 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of XPA expression in transfected 293T cell line by XPA monoclonal antibody (M01), clone 2E4. Lane 1: XPA transfected lysate (Predicted MW: 31.4 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |