| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00007507-M01 |
| Product name: | XPA monoclonal antibody (M01), clone 2E4 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant XPA. |
| Clone: | 2E4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7507 |
| Gene name: | XPA |
| Gene alias: | XP1|XPAC |
| Gene description: | xeroderma pigmentosum, complementation group A |
| Genbank accession: | NM_000380.2 |
| Immunogen: | XPA (NP_000371.1, 1 a.a. ~ 273 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM |
| Protein accession: | NP_000371.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (57.8 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of XPA expression in transfected 293T cell line by XPA monoclonal antibody (M01), clone 2E4. Lane 1: XPA transfected lysate (Predicted MW: 31.4 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |