| Brand: | Abnova |
| Reference: | H00007494-M04 |
| Product name: | XBP1 monoclonal antibody (M04), clone 4E4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant XBP1. |
| Clone: | 4E4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7494 |
| Gene name: | XBP1 |
| Gene alias: | TREB5|XBP2 |
| Gene description: | X-box binding protein 1 |
| Genbank accession: | BC012841 |
| Immunogen: | XBP1 (AAH12841, 123 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | THGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLP |
| Protein accession: | AAH12841 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | XBP1 monoclonal antibody (M04), clone 4E4 Western Blot analysis of XBP1 expression in U-2 OS( Cat # L022V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |