| Brand: | Abnova |
| Reference: | H00007490-M01 |
| Product name: | WT1 monoclonal antibody (M01), clone 2H4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant WT1. |
| Clone: | 2H4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 7490 |
| Gene name: | WT1 |
| Gene alias: | GUD|WAGR|WIT-2|WT33 |
| Gene description: | Wilms tumor 1 |
| Genbank accession: | NM_000378 |
| Immunogen: | WT1 (NP_000369.3, 349 a.a. ~ 439 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTC |
| Protein accession: | NP_000369.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | WT1 monoclonal antibody (M01), clone 2H4 Western Blot analysis of WT1 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |