| Brand: | Abnova |
| Reference: | H00007478-D01 |
| Product name: | WNT8A MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human WNT8A protein. |
| Gene id: | 7478 |
| Gene name: | WNT8A |
| Gene alias: | WNT8D |
| Gene description: | wingless-type MMTV integration site family, member 8A |
| Genbank accession: | NM_058244 |
| Immunogen: | WNT8A (NP_490645.1, 1 a.a. ~ 351 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGNLFMLWAALGICCAAFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAWERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYIITKNCSMGDFENCGCDGSNNGKTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTCKCHGISGSCSIQTCWLQLAEFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSHNTSRWERRSCGRLCTECGLQVEERKTEVISSCNCKFQWCCTVKCDQCRHVVSKYYCARSPGSAQSLGKGSA |
| Protein accession: | NP_490645.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of WNT8A transfected lysate using anti-WNT8A MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with WNT8A purified MaxPab mouse polyclonal antibody (B01P) (H00007478-B01P). |
| Applications: | WB-Tr,IP |
| Shipping condition: | Dry Ice |